![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (9 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein automated matches [190118] (10 species) not a true protein |
![]() | Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [193323] (2 PDB entries) |
![]() | Domain d4gswa_: 4gsw A: [193324] automated match to d3nheb_ complexed with so4 |
PDB Entry: 4gsw (more details), 2.15 Å
SCOPe Domain Sequences for d4gswa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gswa_ d.15.1.1 (A:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} namqifvktltgktitlevepndsidaikakiqekegippdqqrlifagkqleegktlsd yniqkestlhlvlr
Timeline for d4gswa_: