Lineage for d4i30a_ (4i30 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778888Protein automated matches [190035] (28 species)
    not a true protein
  7. 2778976Species Canavalia lineata [TaxId:28957] [193321] (5 PDB entries)
  8. 2778977Domain d4i30a_: 4i30 A: [193322]
    automated match to d2cyfa_
    complexed with abu, ade, ca, mn

Details for d4i30a_

PDB Entry: 4i30 (more details), 1.89 Å

PDB Description: Crystal structure of Canavalia maritima seeds lectin (ConM) co-crystalized with gamma-aminobutyric acid (GABA) and soaked with adenine
PDB Compounds: (A:) Concanavalin-A

SCOPe Domain Sequences for d4i30a_:

Sequence, based on SEQRES records: (download)

>d4i30a_ b.29.1.1 (A:) automated matches {Canavalia lineata [TaxId: 28957]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfvfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfdatftflikssdshpadgiaffisnidssipsgstgrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d4i30a_ b.29.1.1 (A:) automated matches {Canavalia lineata [TaxId: 28957]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklkstna
lhfvfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvhiwess
avvasfdatftflikssdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d4i30a_:

Click to download the PDB-style file with coordinates for d4i30a_.
(The format of our PDB-style files is described here.)

Timeline for d4i30a_: