Lineage for d4gxxa1 (4gxx A:11-324)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775523Species Influenza A virus (a/brevig mission/1/1918(h1n1)) [TaxId:88776] [188803] (5 PDB entries)
  8. 2775524Domain d4gxxa1: 4gxx A:11-324 [193317]
    Other proteins in same PDB: d4gxxa2, d4gxxb_, d4gxxd_, d4gxxe2, d4gxxf_
    automated match to d3gbna_
    complexed with nag

Details for d4gxxa1

PDB Entry: 4gxx (more details), 1.8 Å

PDB Description: crystal structure of the "avianized" 1918 influenza virus hemagglutinin
PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4gxxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gxxa1 b.19.1.2 (A:11-324) Hemagglutinin {Influenza A virus (a/brevig mission/1/1918(h1n1)) [TaxId: 88776]}
dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt
sswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvh
hpptgteqqslyqnadayvsvgsskynrrftpeiaarpkvrgqagrmnyywtllepgdti
tfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvti
gecpkyvrstklrmatglrnip

SCOPe Domain Coordinates for d4gxxa1:

Click to download the PDB-style file with coordinates for d4gxxa1.
(The format of our PDB-style files is described here.)

Timeline for d4gxxa1: