![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
![]() | Protein Hemagglutinin [49824] (22 species) includes rudiment esterase domain |
![]() | Species Influenza A virus (a/brevig mission/1/1918(h1n1)) [TaxId:88776] [188803] (5 PDB entries) |
![]() | Domain d4gxxc_: 4gxx C: [193316] Other proteins in same PDB: d4gxxa2, d4gxxb_, d4gxxd_, d4gxxe2, d4gxxf_ automated match to d3gbna_ complexed with nag |
PDB Entry: 4gxx (more details), 1.8 Å
SCOPe Domain Sequences for d4gxxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gxxc_ b.19.1.2 (C:) Hemagglutinin {Influenza A virus (a/brevig mission/1/1918(h1n1)) [TaxId: 88776]} dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt sswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvh hpptgteqqslyqnadayvsvgsskynrrftpeiaarpkvrgqagrmnyywtllepgdti tfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvti gecpkyvrstklrmatglrnips
Timeline for d4gxxc_: