SCOPe 2.02: Domain d3sgxa_: 3sgx A:

Lineage for d3sgxa_ (3sgx A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156

4. Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families)
   the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase

5. Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins)

6. Protein automated matches [190121] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [193314] (1 PDB entry)

8. Domain d3sgxa_: 3sgx A: [193315]
   automated match to d1x07a_
   complexed with 0fw

Details for d3sgxa_

PDB Entry: 3sgx, 2.45 Å

PDB Description: Crystal Structure of E. coli undecaprenyl pyrophosphate synthase in complex with BPH-1100

PDB Compounds: (A:) undecaprenyl pyrophosphate synthase

SCOPe Domain Sequences for d3sgxa_:

Sequence, based on SEQRES records:

>d3sgxa_ c.101.1.1 (A:) automated matches {Escherichia coli [TaxId: 83333]}
gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafssenwn
rpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntg
ltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtg
gehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafan

Sequence, based on observed residues (ATOM records):

>d3sgxa_ c.101.1.1 (A:) automated matches {Escherichia coli [TaxId: 83333]}
gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafsselme
lfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanygg
rwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisnfllw
qiayaelyftdvlwpdfdeqdfegalnafan

Timeline for d3sgxa_:

• d3sgxa_ is new in SCOPe 2.02-stable
  
• d3sgxa_ appears in SCOPe 2.03
  
• d3sgxa_ appears in the current release, SCOPe 2.08