Lineage for d4au9b_ (4au9 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2950158Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2950159Protein automated matches [190081] (33 species)
    not a true protein
  7. 2950173Species Auricularia auricula-judae [TaxId:29892] [193309] (12 PDB entries)
  8. 2950195Domain d4au9b_: 4au9 B: [193310]
    automated match to d2d3qa1
    complexed with act, gol, hem, nag, tam

Details for d4au9b_

PDB Entry: 4au9 (more details), 2.1 Å

PDB Description: crystal structure of a fungal dyp-type peroxidase from auricularia auricula-judae
PDB Compounds: (B:) dyp-type peroxidase I

SCOPe Domain Sequences for d4au9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4au9b_ d.58.4.0 (B:) automated matches {Auricularia auricula-judae [TaxId: 29892]}
atslntddiqgdilvgmhkqkqlfyffaindpatfktflasdiapvvasvtqlsnvatqp
lvalniafsntgllalgvtdnlgdslfangqakdatsfkestsswvpqfagtgihgviil
asdttdlidqqvasiestfgssisklyslsasirpgneaghemfgfldgiaqpaingfnt
plpgqnivdagviitgatndpitrpswavggsflafrqleqlvpefnkylldnapagsgs
lqaradllgarmvgrwksgapidltptaddpalgadaqrnnnftyshagfdlgsdqshcp
fsahirktrpradlggsltppnlsagansimrsgipygpevtsaesasntttqerglafv
ayqaqlsqgfhflqqtwadnanfppgktpatvgldpiigqnngqprvvngllpsnssasl
sipqfvvshggeyffsppisaiggrlsa

SCOPe Domain Coordinates for d4au9b_:

Click to download the PDB-style file with coordinates for d4au9b_.
(The format of our PDB-style files is described here.)

Timeline for d4au9b_: