Lineage for d1bsxb_ (1bsx B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50844Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
  4. 50845Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 50846Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (14 proteins)
  6. 50943Protein Thyroid hormone receptor beta (TR-beta) [48530] (1 species)
  7. 50944Species Human (Homo sapiens) [TaxId:9606] [48531] (1 PDB entry)
  8. 50946Domain d1bsxb_: 1bsx B: [19331]

Details for d1bsxb_

PDB Entry: 1bsx (more details), 3.7 Å

PDB Description: structure and specificity of nuclear receptor-coactivator interactions

SCOP Domain Sequences for d1bsxb_:

Sequence, based on SEQRES records: (download)

>d1bsxb_ a.123.1.1 (B:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens)}
kpeptdeeweliktvteahvatnaqgshwkqkrkflpedigqapivnapeggkvdleafs
hftkiitpaitrvvdfakklpmfcelpcedqiillkgccmeimslraavrydpesetltl
ngemavtrgqlkngglgvvsdaifdlgmslssfnlddtevallqavllmssdrpglacve
riekyqdsfllafehyinyrkhhvthfwpkllmkvtdlrmigachasrflhmkvecptel
fpplflevfed

Sequence, based on observed residues (ATOM records): (download)

>d1bsxb_ a.123.1.1 (B:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens)}
kpeptdeeweliktvteahvatnaqgshwkqkrkflpedigqapkvdleafshftkiitp
aitrvvdfakklpmfcelpcedqiillkgccmeimslraavrydpesetltlngemavtr
gqlkngglgvvsdaifdlgmslssfnlddtevallqavllmssdrpglacveriekyqds
fllafehyinyrkhhvthfwpkllmkvtdlrmigachasrflhmkvecptelfpplflev
fed

SCOP Domain Coordinates for d1bsxb_:

Click to download the PDB-style file with coordinates for d1bsxb_.
(The format of our PDB-style files is described here.)

Timeline for d1bsxb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bsxa_