Lineage for d3vtta_ (3vtt A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1111574Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1112369Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1112370Protein automated matches [190226] (6 species)
    not a true protein
  7. 1112376Species Dengue virus type 3 [TaxId:408870] [193303] (1 PDB entry)
  8. 1112377Domain d3vtta_: 3vtt A: [193304]
    automated match to d2jsfa1
    complexed with so4

Details for d3vtta_

PDB Entry: 3vtt (more details), 1.7 Å

PDB Description: High Resolution crystal structure of Dengue 3 Envelope protein domain III (ED3)
PDB Compounds: (A:) Envelope protein E

SCOPe Domain Sequences for d3vtta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vtta_ b.1.18.0 (A:) automated matches {Dengue virus type 3 [TaxId: 408870]}
syamclntfvlkkevsetqhgtilikveykgedapckipfstedgqgkahngrlitanpv
vtkkeepvnieaeppfgesnivigigdkalkinwyrkgss

SCOPe Domain Coordinates for d3vtta_:

Click to download the PDB-style file with coordinates for d3vtta_.
(The format of our PDB-style files is described here.)

Timeline for d3vtta_: