Lineage for d3vzza_ (3vzz A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1144404Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 1144405Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 1144609Protein PcrB protein homolog YerE [102046] (2 species)
    provisional classification; it is not known whether this protein binds FMN or not
  7. 1144610Species Bacillus subtilis [TaxId:1423] [102047] (2 PDB entries)
  8. 1144613Domain d3vzza_: 3vzz A: [193302]
    automated match to d1viza_
    complexed with cl, fps, mg

Details for d3vzza_

PDB Entry: 3vzz (more details), 2.04 Å

PDB Description: Crystal structure of PcrB complexed with FsPP from bacillus subtilis subap. subtilis str. 168
PDB Compounds: (A:) Heptaprenylglyceryl phosphate synthase

SCOPe Domain Sequences for d3vzza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vzza_ c.1.4.1 (A:) PcrB protein homolog YerE {Bacillus subtilis [TaxId: 1423]}
mydvtewkhvfkldpnkdlpdeqleilcesgtdaviiggsdgvtednvlrmmskvrrflv
pcvlevsaieaivpgfdlyfipsvlnsknadwivgmhqkamkeygelmsmeeivaegyci
anpdckaaalteadadlnmddivayarvsellqlpifyleysgvlgdieavkktkavlet
stlfygggikdaetakqyaehadvivvgnavyedfdralktvaavk

SCOPe Domain Coordinates for d3vzza_:

Click to download the PDB-style file with coordinates for d3vzza_.
(The format of our PDB-style files is described here.)

Timeline for d3vzza_: