SCOPe 2.04: Domain d3w1sc_: 3w1s C:

Lineage for d3w1sc_ (3w1s C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (10 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193300] (3 PDB entries)

8. Domain d3w1sc_: 3w1s C: [193301]
   automated match to d1wz3a1

Details for d3w1sc_

PDB Entry: 3w1s, 2.6 Å

PDB Description: Crystal structure of Saccharomyces cerevisiae Atg12-Atg5 conjugate bound to the N-terminal domain of Atg16

PDB Compounds: (C:) Ubiquitin-like protein ATG12

SCOPe Domain Sequences for d3w1sc_:

Sequence, based on SEQRES records:

>d3w1sc_ d.15.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
iqkiqikfqpigsigqlkpsvckismsqsfamvilflkrrlkmdhvycyinnsfapspqq
nigelwmqfktndelivsycasvafg

Sequence, based on observed residues (ATOM records):

>d3w1sc_ d.15.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
iqkiqikfqpigsvckismsqsfamvilflkrrlkmdhvycyinnsfapspqqnigelwm
qfktndelivsycafg

Timeline for d3w1sc_:

• d3w1sc_ first appeared in SCOPe 2.02
  
• d3w1sc_ appears in SCOPe 2.03
  
• d3w1sc_ appears in SCOPe 2.05
  
• d3w1sc_ appears in the current release, SCOPe 2.08