Lineage for d1bsxa_ (1bsx A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6345Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
  4. 6346Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 6347Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (12 proteins)
  6. 6424Protein Thyroid hormone receptor beta (TR-beta) [48530] (1 species)
  7. 6425Species Human (Homo sapiens) [TaxId:9606] [48531] (1 PDB entry)
  8. 6426Domain d1bsxa_: 1bsx A: [19330]

Details for d1bsxa_

PDB Entry: 1bsx (more details), 3.7 Å

PDB Description: structure and specificity of nuclear receptor-coactivator interactions

SCOP Domain Sequences for d1bsxa_:

Sequence, based on SEQRES records: (download)

>d1bsxa_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens)}
kpeptdeeweliktvteahvatnaqgshwkqkrkflpedigqapivnapeggkvdleafs
hftkiitpaitrvvdfakklpmfcelpcedqiillkgccmeimslraavrydpesetltl
ngemavtrgqlkngglgvvsdaifdlgmslssfnlddtevallqavllmssdrpglacve
riekyqdsfllafehyinyrkhhvthfwpkllmkvtdlrmigachasrflhmkvecptel
fpplflevfed

Sequence, based on observed residues (ATOM records): (download)

>d1bsxa_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens)}
kpeptdeeweliktvteahvatnaqgshwkqkrkflpedigqapkvdleafshftkiitp
aitrvvdfakklpmfcelpcedqiillkgccmeimslraavrydpesetltlngemavtr
gqlkngglgvvsdaifdlgmslssfnlddtevallqavllmssdrpglacveriekyqds
fllafehyinyrkhhvthfwpkllmkvtdlrmigachasrflhmkvecptelfpplflev
fed

SCOP Domain Coordinates for d1bsxa_:

Click to download the PDB-style file with coordinates for d1bsxa_.
(The format of our PDB-style files is described here.)

Timeline for d1bsxa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bsxb_