SCOPe 2.05: Domain d2h6ta_: 2h6t A:

Lineage for d2h6ta_ (2h6t A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein automated matches [190156] (4 species)
   not a true protein

7. Species Yeast (Candida albicans) [TaxId:5476] [188488] (4 PDB entries)

8. Domain d2h6ta_: 2h6t A: [193299]
   automated match to d2h6sa_
   complexed with zn

Details for d2h6ta_

PDB Entry: 2h6t, 1.9 Å

PDB Description: secreted aspartic proteinase (sap) 3 from candida albicans complexed with pepstatin a

PDB Compounds: (A:) Candidapepsin-3

SCOPe Domain Sequences for d2h6ta_:

Sequence; same for both SEQRES and ATOM records:

>d2h6ta_ b.50.1.2 (A:) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
qtvpvklineqvsyasditvgsnkqkltvvidtgssdlwvpdsqvscqagqgqdpnfckn
egtyspssssssqnlnspfsieygdgttsqgtwykdtigfggisitkqqfadvtstsvdq
gilgigyktheaegnydnvpvtlknqgiisknayslylnsrqatsgqiifggvdnakysg
tlialpvtsdnelrihlntvkvagqsinadvdvlldsgttitylqqgvadqvisafngqe
tydangnlfylvdcnlsgsvdfafdknakisvpaseftaplytedgqvydqcqllfgtsd
ynilgdnflrsayivydlddneislaqvkyttasniaalt

Timeline for d2h6ta_:

• d2h6ta_ first appeared in SCOPe 2.02
  
• d2h6ta_ appears in SCOPe 2.04
  
• d2h6ta_ appears in SCOPe 2.06
  
• d2h6ta_ appears in the current release, SCOPe 2.08