Lineage for d2h6ta_ (2h6t A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2392462Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2393721Protein automated matches [190156] (5 species)
    not a true protein
  7. 2393798Species Yeast (Candida albicans) [TaxId:5476] [188488] (4 PDB entries)
  8. 2393799Domain d2h6ta_: 2h6t A: [193299]
    automated match to d2h6sa_
    complexed with zn

Details for d2h6ta_

PDB Entry: 2h6t (more details), 1.9 Å

PDB Description: secreted aspartic proteinase (sap) 3 from candida albicans complexed with pepstatin a
PDB Compounds: (A:) Candidapepsin-3

SCOPe Domain Sequences for d2h6ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h6ta_ b.50.1.2 (A:) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
qtvpvklineqvsyasditvgsnkqkltvvidtgssdlwvpdsqvscqagqgqdpnfckn
egtyspssssssqnlnspfsieygdgttsqgtwykdtigfggisitkqqfadvtstsvdq
gilgigyktheaegnydnvpvtlknqgiisknayslylnsrqatsgqiifggvdnakysg
tlialpvtsdnelrihlntvkvagqsinadvdvlldsgttitylqqgvadqvisafngqe
tydangnlfylvdcnlsgsvdfafdknakisvpaseftaplytedgqvydqcqllfgtsd
ynilgdnflrsayivydlddneislaqvkyttasniaalt

SCOPe Domain Coordinates for d2h6ta_:

Click to download the PDB-style file with coordinates for d2h6ta_.
(The format of our PDB-style files is described here.)

Timeline for d2h6ta_: