Class b: All beta proteins [48724] (176 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.0: automated matches [191454] (1 protein) not a true family |
Protein automated matches [190698] (16 species) not a true protein |
Species Rhodnius prolixus [TaxId:13249] [193297] (8 PDB entries) |
Domain d4ge1a_: 4ge1 A: [193298] automated match to d2eu7x_ complexed with gol, tss |
PDB Entry: 4ge1 (more details), 2.15 Å
SCOPe Domain Sequences for d4ge1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ge1a_ b.60.1.0 (A:) automated matches {Rhodnius prolixus [TaxId: 13249]} sgcstvdtvkdfnkdnfftgswyithyklgdstlevgdknctkflhqktadgkikevfsn ynpnaktysydisfakvsdfdgnngkytaknvivekdgrkidertlqvsyidtdyskysv vhvcdpaapdyylyavqsrtenvkedvkskveaalgkvglklsglfdattlgnkcqydde tlqkllkqsfpnyek
Timeline for d4ge1a_: