Lineage for d1db1a_ (1db1 A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6345Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
  4. 6346Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 6347Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (12 protein domains)
  6. 6436Protein Vitamin D nuclear receptor [48528] (1 species)
  7. 6437Species Human (Homo sapiens) [TaxId:9606] [48529] (1 PDB entry)
  8. 6438Domain d1db1a_: 1db1 A: [19329]

Details for d1db1a_

PDB Entry: 1db1 (more details), 1.8 Å

PDB Description: crystal structure of the nuclear receptor for vitamin d complexed to vitamin d

SCOP Domain Sequences for d1db1a_:

Sequence, based on SEQRES records: (download)

>d1db1a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens)}
lrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlphl
adlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcgn
qdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaa
lieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqpec
smkltplvlevfg

Sequence, based on observed residues (ATOM records): (download)

>d1db1a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens)}
lrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlphl
adlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcgn
qdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaa
lieaiqdrlsntlqtyircrhpppllyakmiqkladlrslneehskqyrclsfqpecsmk
ltplvlevfg

SCOP Domain Coordinates for d1db1a_:

Click to download the PDB-style file with coordinates for d1db1a_.
(The format of our PDB-style files is described here.)

Timeline for d1db1a_: