Lineage for d1db1a_ (1db1 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009359Protein Vitamin D nuclear receptor [48528] (2 species)
  7. 2009360Species Human (Homo sapiens) [TaxId:9606] [48529] (28 PDB entries)
  8. 2009370Domain d1db1a_: 1db1 A: [19329]
    complexed with vdx

Details for d1db1a_

PDB Entry: 1db1 (more details), 1.8 Å

PDB Description: crystal structure of the nuclear receptor for vitamin d complexed to vitamin d
PDB Compounds: (A:) vitamin d nuclear receptor

SCOPe Domain Sequences for d1db1a_:

Sequence, based on SEQRES records: (download)

>d1db1a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]}
lrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlphl
adlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcgn
qdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaa
lieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqpec
smkltplvlevfg

Sequence, based on observed residues (ATOM records): (download)

>d1db1a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]}
lrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlphl
adlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcgn
qdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaa
lieaiqdrlsntlqtyircrhpppllyakmiqkladlrslneehskqyrclsfqpecsmk
ltplvlevfg

SCOPe Domain Coordinates for d1db1a_:

Click to download the PDB-style file with coordinates for d1db1a_.
(The format of our PDB-style files is described here.)

Timeline for d1db1a_: