Lineage for d4g6da_ (4g6d A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1081117Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (3 families) (S)
  5. 1081150Family a.4.13.2: Sigma4 domain [88665] (5 proteins)
  6. 1081197Protein automated matches [193280] (1 species)
    not a true protein
  7. 1081198Species Staphylococcus aureus [TaxId:93061] [193281] (1 PDB entry)
  8. 1081199Domain d4g6da_: 4g6d A: [193282]
    automated match to d1ttya_
    protein/DNA complex; protein/RNA complex

Details for d4g6da_

PDB Entry: 4g6d (more details), 2 Å

PDB Description: G1 ORF67 / Staphyloccus aureus sigmaA domain 4 complex
PDB Compounds: (A:) RNA polymerase sigma factor rpoD

SCOPe Domain Sequences for d4g6da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g6da_ a.4.13.2 (A:) automated matches {Staphylococcus aureus [TaxId: 93061]}
mkeqledvldtltdreenvlrlrfglddgrtrtleevgkvfgvtrerirqieakalrklr
hp

SCOPe Domain Coordinates for d4g6da_:

Click to download the PDB-style file with coordinates for d4g6da_.
(The format of our PDB-style files is described here.)

Timeline for d4g6da_: