Lineage for d4hy0a_ (4hy0 A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2642738Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 2642739Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 2642740Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 2642874Protein automated matches [190700] (1 species)
    not a true protein
  7. 2642875Species Human (Homo sapiens) [TaxId:9606] [187840] (48 PDB entries)
  8. 2642925Domain d4hy0a_: 4hy0 A: [193270]
    automated match to d1tfqa_
    complexed with 1aq, zn

Details for d4hy0a_

PDB Entry: 4hy0 (more details), 2.84 Å

PDB Description: Crystal structure of XIAP BIR3 with T3256336
PDB Compounds: (A:) E3 ubiquitin-protein ligase XIAP

SCOPe Domain Sequences for d4hy0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hy0a_ g.52.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkps
edpweqhakwypgckylleqkgqeyinnihlthsle

SCOPe Domain Coordinates for d4hy0a_:

Click to download the PDB-style file with coordinates for d4hy0a_.
(The format of our PDB-style files is described here.)

Timeline for d4hy0a_: