Lineage for d1gwxa_ (1gwx A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1097039Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1097040Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1097041Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1097589Protein Peroxisome proliferator-activated receptor delta, PPAR-DELTA [48526] (1 species)
  7. 1097590Species Human (Homo sapiens) [TaxId:9606] [48527] (14 PDB entries)
  8. 1097614Domain d1gwxa_: 1gwx A: [19327]
    complexed with 433

Details for d1gwxa_

PDB Entry: 1gwx (more details), 2.5 Å

PDB Description: molecular recognition of fatty acids by peroxisome proliferator-activated receptors
PDB Compounds: (A:) protein (ppar-delta)

SCOPe Domain Sequences for d1gwxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gwxa_ a.123.1.1 (A:) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
qvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkq
lvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheai
famlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlal
fiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlv
tehaqmmqrikktetetslhpllqeiykdmy

SCOPe Domain Coordinates for d1gwxa_:

Click to download the PDB-style file with coordinates for d1gwxa_.
(The format of our PDB-style files is described here.)

Timeline for d1gwxa_: