SCOPe 2.04: Domain d3vq9a_: 3vq9 A:

Lineage for d3vq9a_ (3vq9 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)

6. Protein Retroviral integrase, catalytic domain [53108] (3 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (42 PDB entries)

8. Domain d3vq9a_: 3vq9 A: [193266]
   automated match to d1bl3c_
   protein/DNA complex; complexed with fbb

Details for d3vq9a_

PDB Entry: 3vq9, 1.9 Å

PDB Description: HIV-1 IN core domain in complex with 6-fluoro-1,3-benzothiazol-2-amine

PDB Compounds: (A:) Pol polyprotein

SCOPe Domain Sequences for d3vq9a_:

Sequence, based on SEQRES records:

>d3vq9a_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkggiggysagerivdiiatdi

Sequence, based on observed residues (ATOM records):

>d3vq9a_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqefgiesmnkelkkiigqvrdqaehlktavqmavfihnhk
rkggiggysagerivdiiatdi

Timeline for d3vq9a_:

• d3vq9a_ first appeared in SCOPe 2.02
  
• d3vq9a_ appears in SCOPe 2.03
  
• d3vq9a_ appears in SCOPe 2.05
  
• d3vq9a_ appears in the current release, SCOPe 2.08