SCOPe 2.08: Domain d4eokc1: 4eok C:1-297

Lineage for d4eokc1 (4eok C:1-297)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
   CMGC group; CDKs subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [88856] (417 PDB entries)
   Uniprot P24941

8. Domain d4eokc1: 4eok C:1-297 [193264]
   Other proteins in same PDB: d4eoka2, d4eokb1, d4eokb2, d4eokc2, d4eokd1, d4eokd2
   automated match to d3bhta_
   complexed with 4sp, sgm

Details for d4eokc1

PDB Entry: 4eok, 2.57 Å

PDB Description: thr 160 phosphorylated cdk2 h84s, q85m, k89d - human cyclin a3 complex with the inhibitor nu6102

PDB Compounds: (C:) cyclin-dependent kinase 2

SCOPe Domain Sequences for d4eokc1:

Sequence; same for both SEQRES and ATOM records:

>d4eokc1 d.144.1.7 (C:1-297) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
menfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh
pnivklldvihtenklylvfeflsmdlkdfmdasaltgiplpliksylfqllqglafchs
hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy
stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf
pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr

Timeline for d4eokc1:

• d4eokc1 first appeared in SCOPe 2.02, called d4eokc_
  
• d4eokc1 appears in SCOPe 2.07