Lineage for d3u41c_ (3u41 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736108Fold a.184: TorD-like [89154] (1 superfamily)
    multihelical; bundle
  4. 2736109Superfamily a.184.1: TorD-like [89155] (1 family) (S)
  5. 2736110Family a.184.1.1: TorD-like [89156] (5 proteins)
    Pfam PF06192
  6. 2736126Protein automated matches [191026] (2 species)
    not a true protein
  7. 2736132Species Escherichia coli K-12 [TaxId:83333] [188829] (3 PDB entries)
  8. 2736141Domain d3u41c_: 3u41 C: [193260]
    automated match to d3efpa_
    complexed with cl, gol, peg, so4, trs

Details for d3u41c_

PDB Entry: 3u41 (more details), 2.5 Å

PDB Description: crystal structure of escherichia coli dmsd in space group p212121
PDB Compounds: (C:) Twin-arginine leader-binding protein dmsD

SCOPe Domain Sequences for d3u41c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u41c_ a.184.1.1 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mthfsqqdnfsvaarvlgalfyyapesaeaaplvavltsdgwetqwplpeaslaplvtaf
qtqceethaqawqrlfvgpwalpsppwgsvwldresvlfgdstlalrqwmrekgiqfemk
qnepedhfgslllmaawlaengrqteceellawhlfpwstrfldvfiekaehpfyralge
larltlaqwqsqllipvavkplfr

SCOPe Domain Coordinates for d3u41c_:

Click to download the PDB-style file with coordinates for d3u41c_.
(The format of our PDB-style files is described here.)

Timeline for d3u41c_: