SCOPe 2.02: Domain d4ffda_: 4ffd A:

Lineage for d4ffda_ (4ffd A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.1: HAD-related [56785] (3 proteins)
   the insertion subdomain is a 4-helical bundle

6. Protein automated matches [191260] (1 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:53953] [189820] (2 PDB entries)

8. Domain d4ffda_: 4ffd A: [193256]
   automated match to d3u26a_
   complexed with mg

Details for d4ffda_

PDB Entry: 4ffd, 2.31 Å

PDB Description: Crystal structure of engineered protein. northeast structural genomics consortium target or48

PDB Compounds: (A:) PF00702 domain protein

SCOPe Domain Sequences for d4ffda_:

Sequence; same for both SEQRES and ATOM records:

>d4ffda_ c.108.1.1 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
miravffdslgtlnsvegaakshlkimeevlgdyplnpktlldeyekltreafsnyagkp
yrplrdileevmrklaekygfkypenfweislrmsqrygelypevvevlkslkgkyhvgm
itdsdteqamafldalgikdlfdsittseeagffkphprifelalkkagvkgeeavyvgd
npvkdcggsknlgmtsilldrkgekrefwdkcdfivsdlrevikivdeln

Timeline for d4ffda_:

• d4ffda_ is new in SCOPe 2.02-stable
  
• d4ffda_ appears in SCOPe 2.03
  
• d4ffda_ appears in the current release, SCOPe 2.08, called d4ffda1