Lineage for d2gwxb_ (2gwx B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6345Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
  4. 6346Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 6347Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (12 proteins)
  6. 6386Protein Peroxisome proliferator-activated receptor delta, PPAR-DELTA [48526] (1 species)
  7. 6387Species Human (Homo sapiens) [TaxId:9606] [48527] (3 PDB entries)
  8. 6389Domain d2gwxb_: 2gwx B: [19324]

Details for d2gwxb_

PDB Entry: 2gwx (more details), 2.3 Å

PDB Description: molecular recognition of fatty acids by peroxisome proliferator-activated receptors

SCOP Domain Sequences for d2gwxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gwxb_ a.123.1.1 (B:) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens)}
lkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkqlvng
lppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifaml
asivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaa
iilcgdrpglmnvprveaiqdtilralefhlqanhpdaqqlfpkllqkmadlrqlvteha
qmmqrikktetetslhpllqeiykdmy

SCOP Domain Coordinates for d2gwxb_:

Click to download the PDB-style file with coordinates for d2gwxb_.
(The format of our PDB-style files is described here.)

Timeline for d2gwxb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2gwxa_