Lineage for d2gwxb_ (2gwx B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009141Protein Peroxisome proliferator-activated receptor delta, PPAR-DELTA [48526] (1 species)
  7. 2009142Species Human (Homo sapiens) [TaxId:9606] [48527] (16 PDB entries)
  8. 2009152Domain d2gwxb_: 2gwx B: [19324]

Details for d2gwxb_

PDB Entry: 2gwx (more details), 2.3 Å

PDB Description: molecular recognition of fatty acids by peroxisome proliferator-activated receptors
PDB Compounds: (B:) protein (ppar-delta)

SCOPe Domain Sequences for d2gwxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gwxb_ a.123.1.1 (B:) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
lkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkqlvng
lppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifaml
asivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaa
iilcgdrpglmnvprveaiqdtilralefhlqanhpdaqqlfpkllqkmadlrqlvteha
qmmqrikktetetslhpllqeiykdmy

SCOPe Domain Coordinates for d2gwxb_:

Click to download the PDB-style file with coordinates for d2gwxb_.
(The format of our PDB-style files is described here.)

Timeline for d2gwxb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2gwxa_