Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.3: EsxAB dimer-like [140453] (2 families) (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals |
Family a.25.3.0: automated matches [193224] (1 protein) not a true family |
Protein automated matches [193225] (3 species) not a true protein |
Species Bacillus anthracis [TaxId:260799] [193226] (8 PDB entries) |
Domain d4j7kd_: 4j7k D: [193227] automated match to d3favc_ mutant |
PDB Entry: 4j7k (more details), 1.66 Å
SCOPe Domain Sequences for d4j7kd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j7kd_ a.25.3.0 (D:) automated matches {Bacillus anthracis [TaxId: 260799]} eikitpeeleriagnfknaageaqsqinrlegdinslegqwagatqakfrgqfiqskqam qqyipilegistdlkriadkfrnt
Timeline for d4j7kd_: