Lineage for d4prgd_ (4prg D:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 360318Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 360319Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 360320Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (27 proteins)
  6. 360454Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 360455Species Human (Homo sapiens) [TaxId:9606] [48525] (10 PDB entries)
  8. 360474Domain d4prgd_: 4prg D: [19322]
    complexed with 072

Details for d4prgd_

PDB Entry: 4prg (more details), 2.9 Å

PDB Description: 0072 partial agonist ppar gamma cocrystal

SCOP Domain Sequences for d4prgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4prgd_ a.123.1.1 (D:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens)}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdl

SCOP Domain Coordinates for d4prgd_:

Click to download the PDB-style file with coordinates for d4prgd_.
(The format of our PDB-style files is described here.)

Timeline for d4prgd_: