Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein automated matches [190091] (10 species) not a true protein |
Species Homo sapiens [TaxId:9606] [192729] (55 PDB entries) |
Domain d3vo3a_: 3vo3 A: [193217] automated match to d2p2ha_ complexed with 0kf, edo |
PDB Entry: 3vo3 (more details), 1.52 Å
SCOPe Domain Sequences for d3vo3a_:
Sequence, based on SEQRES records: (download)
>d3vo3a_ d.144.1.7 (A:) automated matches {Homo sapiens [TaxId: 9606]} pldehcerlpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlk egathsehralmselkilihighhlnvvnllgactkpggplmvivefckfgnlstylrsk rnefvpykeapedlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknv vkicdfglardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifsl gaspypgvkideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlg nllqana
>d3vo3a_ d.144.1.7 (A:) automated matches {Homo sapiens [TaxId: 9606]} pldehcerlpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlk egathsehralmselkilihighhlnvvnllgactkpggplmvivefckfgnlstylrsk rnefvpykdlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkic dfglardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslgasp ypgvkideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgnllq ana
Timeline for d3vo3a_: