Lineage for d3vo3a_ (3vo3 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545083Protein Vascular endothelial growth factor receptor 2 (kdr) [56160] (1 species)
    PTK group; PDGFR/VEGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2545084Species Human (Homo sapiens) [TaxId:9606] [56161] (25 PDB entries)
  8. 2545085Domain d3vo3a_: 3vo3 A: [193217]
    automated match to d2p2ha_
    complexed with 0kf, edo

Details for d3vo3a_

PDB Entry: 3vo3 (more details), 1.52 Å

PDB Description: Crystal Structure of the Kinase domain of Human VEGFR2 with imidazo[1,2-b]pyridazine derivative
PDB Compounds: (A:) Vascular endothelial growth factor receptor 2

SCOPe Domain Sequences for d3vo3a_:

Sequence, based on SEQRES records: (download)

>d3vo3a_ d.144.1.7 (A:) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]}
pldehcerlpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlk
egathsehralmselkilihighhlnvvnllgactkpggplmvivefckfgnlstylrsk
rnefvpykeapedlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknv
vkicdfglardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifsl
gaspypgvkideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlg
nllqana

Sequence, based on observed residues (ATOM records): (download)

>d3vo3a_ d.144.1.7 (A:) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]}
pldehcerlpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlk
egathsehralmselkilihighhlnvvnllgactkpggplmvivefckfgnlstylrsk
rnefvpykdlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkic
dfglardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslgasp
ypgvkideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgnllq
ana

SCOPe Domain Coordinates for d3vo3a_:

Click to download the PDB-style file with coordinates for d3vo3a_.
(The format of our PDB-style files is described here.)

Timeline for d3vo3a_: