Lineage for d2jhya_ (2jhy A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1111574Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1112047Family b.1.18.8: RhoGDI-like [81288] (3 proteins)
  6. 1112100Protein automated matches [190534] (1 species)
    not a true protein
  7. 1112101Species Human (Homo sapiens) [TaxId:9606] [187499] (7 PDB entries)
  8. 1112103Domain d2jhya_: 2jhy A: [193215]
    automated match to d2jhza_
    mutant

Details for d2jhya_

PDB Entry: 2jhy (more details), 1.9 Å

PDB Description: crystal structure of rhogdi e155h, e157h mutant
PDB Compounds: (A:) rho GDP-dissociation inhibitor 1

SCOPe Domain Sequences for d2jhya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jhya_ b.1.18.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
amvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs
gmkyiqhtyrkgvkidktdymvgsygpraehyhfltpveeapkgmlargsysiksrftdd
dktdhlswewnltikkdw

SCOPe Domain Coordinates for d2jhya_:

Click to download the PDB-style file with coordinates for d2jhya_.
(The format of our PDB-style files is described here.)

Timeline for d2jhya_: