SCOPe 2.05: Domain d2j05b_: 2j05 B:

Lineage for d2j05b_ (2j05 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187598] (88 PDB entries)

8. Domain d2j05b_: 2j05 B: [193210]
   automated match to d3i35a_

Details for d2j05b_

PDB Entry: 2j05, 1.5 Å

PDB Description: crystal structure of the rasgap sh3 domain at 1.5 angstrom resolution

PDB Compounds: (B:) Ras GTPase-activating protein 1

SCOPe Domain Sequences for d2j05b_:

Sequence; same for both SEQRES and ATOM records:

>d2j05b_ b.34.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrrvrailpytkvpdtdeisflkgdmfivhneledgwmwvtnlrtdeqglivedlveevg

Timeline for d2j05b_:

• d2j05b_ first appeared in SCOPe 2.02
  
• d2j05b_ appears in SCOPe 2.04
  
• d2j05b_ appears in SCOPe 2.06
  
• d2j05b_ appears in the current release, SCOPe 2.08