Lineage for d2ihea_ (2ihe A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2051128Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2052191Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2052192Protein automated matches [190576] (33 species)
    not a true protein
  7. 2052325Species Thermus aquaticus [TaxId:271] [187860] (3 PDB entries)
  8. 2052328Domain d2ihea_: 2ihe A: [193209]
    automated match to d2ihfa_

Details for d2ihea_

PDB Entry: 2ihe (more details), 2.1 Å

PDB Description: crystal structure of wild-type single-stranded dna binding protein from thermus aquaticus
PDB Compounds: (A:) Single-stranded DNA-binding protein

SCOPe Domain Sequences for d2ihea_:

Sequence, based on SEQRES records: (download)

>d2ihea_ b.40.4.0 (A:) automated matches {Thermus aquaticus [TaxId: 271]}
arglnqvfligtltarpdmrytpgglaildlnlagqdaftdesgqerevpwyhrvrllgr
qaemwgdllekgqlifvegrleyrqwekdgekksevqvraefidplegrgretledargq
prlrralnqvilmgnltrdpdlrytpqgtavvrlglavnerrrgqeeerthflevqawre
laewaselrkgdgllvigrlvndswtsssgerrfqtrvealrlerptrgpaqaggsrp

Sequence, based on observed residues (ATOM records): (download)

>d2ihea_ b.40.4.0 (A:) automated matches {Thermus aquaticus [TaxId: 271]}
arglnqvfligtltarpdmrytpgglaildlnlagqdaftdesgqerevpwyhrvrllgr
qaemwgdllekgqlifvegrleyrqwekdgekksevqvraefidplegrgalnqvilmgn
ltrdpdlrytpqgtavvrlglavnerthflevqawrelaewaselrkgdgllvigrlvnd
rfqtrvealrlerptrgpaqaggsrp

SCOPe Domain Coordinates for d2ihea_:

Click to download the PDB-style file with coordinates for d2ihea_.
(The format of our PDB-style files is described here.)

Timeline for d2ihea_: