Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) |
Family c.1.18.0: automated matches [191539] (1 protein) not a true family |
Protein automated matches [190919] (10 species) not a true protein |
Species Red algae (Galdieria sulphuraria) [TaxId:130081] [193207] (1 PDB entry) |
Domain d2o55a_: 2o55 A: [193208] automated match to d2pz0a_ complexed with so4 |
PDB Entry: 2o55 (more details), 2.81 Å
SCOPe Domain Sequences for d2o55a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o55a_ c.1.18.0 (A:) automated matches {Red algae (Galdieria sulphuraria) [TaxId: 130081]} skviipkivghrgvgkeglapentlrsfvlcmernipyietdlrvcktgeivlfhgtpeg tipfykdgtsrigdlsleelkrldvggghtipsleelfvaieeqkfnlklnlelkgeewk rkesgdhqrllllvekyhmqervdycsfhhealahlkalcpdvkitylfnymgqptpldf veqacygdangvsmlfhyltkeqvctahekglsvtvwmpwifddseedwkkclelqvdli csnypfglmnflsn
Timeline for d2o55a_: