Lineage for d4prgb_ (4prg B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2341332Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2341917Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 2341918Species Human (Homo sapiens) [TaxId:9606] [48525] (167 PDB entries)
    Uniprot P37231 232-505
  8. 2342204Domain d4prgb_: 4prg B: [19320]
    complexed with 072

Details for d4prgb_

PDB Entry: 4prg (more details), 2.9 Å

PDB Description: 0072 partial agonist ppar gamma cocrystal
PDB Compounds: (B:) protein (peroxisome proliferator activated receptor gamma)

SCOPe Domain Sequences for d4prgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4prgb_ a.123.1.1 (B:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdl

SCOPe Domain Coordinates for d4prgb_:

Click to download the PDB-style file with coordinates for d4prgb_.
(The format of our PDB-style files is described here.)

Timeline for d4prgb_: