Lineage for d4prgb_ (4prg B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) 
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (12 proteins) 
Protein Peroxisome proliferator activated receptor gamma, PPAR-RXR [48524] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48525] (6 PDB entries) 
Domain d4prgb_: 4prg B: [19320]
Details for d4prgb_
PDB Entry: 4prg (more details), 2.9 Å
PDB Description: 0072 partial agonist ppar gamma cocrystal
SCOP Domain Sequences for d4prgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4prgb_ a.123.1.1 (B:) Peroxisome proliferator activated receptor gamma, PPAR-RXR {Human (Homo sapiens)}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdl
SCOP Domain Coordinates for d4prgb_:
Click to download the PDB-style file with coordinates for d4prgb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4prgb_:
- d4prgb_ appears in SCOP 1.57
- d4prgb_ appears in the current release, SCOPe 2.08
View in 3D
