SCOPe 2.04: Domain d2hcma_: 2hcm A:

Lineage for d2hcma_ (2hcm A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.0: automated matches [191381] (1 protein)
   not a true family

6. Protein automated matches [190475] (6 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [193198] (1 PDB entry)

8. Domain d2hcma_: 2hcm A: [193199]
   automated match to d2nt2a_
   complexed with gol, na, wo4, zn

Details for d2hcma_

PDB Entry: 2hcm, 2 Å

PDB Description: crystal structure of mouse putative dual specificity phosphatase complexed with zinc tungstate, new york structural genomics consortium

PDB Compounds: (A:) Dual specificity protein phosphatase

SCOPe Domain Sequences for d2hcma_:

Sequence; same for both SEQRES and ATOM records:

>d2hcma_ c.45.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
slgtseaapppfarvapalfignaraagatellvragitlcvnvsrqqpgprapgvaelr
vpvfddpaedllthleptcaameaavrdggsclvyckngrsrsaavctaylmrhrghsld
rafqmvksarpvaepnlgfwaqlqkyeqtlqaqailpre

Timeline for d2hcma_:

• d2hcma_ first appeared in SCOPe 2.02
  
• d2hcma_ appears in SCOPe 2.03
  
• d2hcma_ appears in SCOPe 2.05
  
• d2hcma_ appears in the current release, SCOPe 2.08, called d2hcma1