Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (18 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187449] (19 PDB entries) |
Domain d1zy5b_: 1zy5 B: [193196] automated match to d2a19c_ complexed with anp, mg; mutant |
PDB Entry: 1zy5 (more details), 2 Å
SCOPe Domain Sequences for d1zy5b_:
Sequence, based on SEQRES records: (download)
>d1zy5b_ d.144.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} slryasdfeeiavlgqgafgqvvkarnaldsryyaikkirhteeklstilsevmllasln hqyvvryyaawlerrnfvkpmtavkkkstlfiqmeycengtlydlihsenlnqqrdeywr lfrqilealsyihsqgiihrdlkpmnifidesrnvkigdfglaknvhrsldilkldsqnl pgssdnltsaigtamyvatevldgtghynekidmyslgiiffemiypfstgmervnilkk lrsvsiefppdfddnkmkvekkiirllidhdpnkrpgartllnsgwlpv
>d1zy5b_ d.144.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} slryasdfeeiavlgqgafgqvvkarnaldsryyaikkirhteeklstilsevmllasln hqyvvryyaawlerrnfvkkstlfiqmeycengtlydlihsenlnqqrdeywrlfrqile alsyihsqgiihrdlkpmnifidesrnvkigdfglgtamyvatevlhynekidmyslgii ffemiypfstgmervnilkklrsvsiefppdfddnkmkvekkiirllidhdpnkrpgart llnsgwlpv
Timeline for d1zy5b_: