Lineage for d2aa6b_ (2aa6 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009403Protein automated matches [190059] (14 species)
    not a true protein
  7. 2009425Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2009464Domain d2aa6b_: 2aa6 B: [193194]
    automated match to d3vhva_
    complexed with str; mutant

Details for d2aa6b_

PDB Entry: 2aa6 (more details), 1.95 Å

PDB Description: mineralocorticoid receptor s810l mutant with bound progesterone
PDB Compounds: (B:) Mineralocorticoid receptor

SCOPe Domain Sequences for d2aa6b_:

Sequence, based on SEQRES records: (download)

>d2aa6b_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alvpqlstisraltpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvv
kwakvlpgfknlpledqitliqyswmsllsfalswrsykhtnsqflyfapdlvfneekmh
qsamyelcqgmhqislqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyik
elrkmvtkcpnnsgqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlv
eiisdqlpkvesgnakplyfh

Sequence, based on observed residues (ATOM records): (download)

>d2aa6b_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alvpqlstisraltpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvv
kwakvlpgfknlpledqitliqyswmsllsfalswrsykhtnsqflyfapdlvfneekmh
qsamyelcqgmhqislqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyik
elrkmvtpnnsgqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlvei
isdqlpkvesgnakplyfh

SCOPe Domain Coordinates for d2aa6b_:

Click to download the PDB-style file with coordinates for d2aa6b_.
(The format of our PDB-style files is described here.)

Timeline for d2aa6b_: