Lineage for d2h0fb_ (2h0f B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1113318Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1113483Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 1113877Family b.3.4.0: automated matches [191441] (1 protein)
    not a true family
  6. 1113878Protein automated matches [190651] (6 species)
    not a true protein
  7. 1113879Species Bacillus subtilis [TaxId:1423] [193190] (1 PDB entry)
  8. 1113880Domain d2h0fb_: 2h0f B: [193191]
    automated match to d2g2nc_
    complexed with aza

Details for d2h0fb_

PDB Entry: 2h0f (more details), 2.7 Å

PDB Description: crystal structure of pucm in the presence of 8-azaxanthine
PDB Compounds: (B:) Transthyretin-like protein pucM

SCOPe Domain Sequences for d2h0fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h0fb_ b.3.4.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
mgkltthildltcgkpaanvkiglkrlgesimkevytnndgrvdvpllageelmsgeyvm
efhagdyfasknmnaadqpfltivtvrfqladpdahyhiplllspfgyqvyrgs

SCOPe Domain Coordinates for d2h0fb_:

Click to download the PDB-style file with coordinates for d2h0fb_.
(The format of our PDB-style files is described here.)

Timeline for d2h0fb_: