Lineage for d4edsa_ (4eds A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2184480Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2184481Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2184482Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2184772Protein automated matches [190406] (19 species)
    not a true protein
  7. 2185088Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [188538] (21 PDB entries)
  8. 2185096Domain d4edsa_: 4eds A: [193187]
    automated match to d3pj7c_

Details for d4edsa_

PDB Entry: 4eds (more details), 1.6 Å

PDB Description: Crystal structure of far-red fluorescent protein eqFP670
PDB Compounds: (A:) far-red fluorescent protein eqFP650

SCOPe Domain Sequences for d4edsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4edsa_ d.22.1.1 (A:) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
elisenmhtklymegtvnghhfkctsegegkpyegtqtckikvveggplpfafdilatsf
mygsktfinhtqgipdffkqsfpegftwerittyedggvltatqdtslqngcliynvkin
gvnfpsngpvmqkktlgweantemlypadsglrghnqmalklvgggylhcslkttyrskk
paknlkmpgfyfvdrklerikeadketyveqhemavarycd

SCOPe Domain Coordinates for d4edsa_:

Click to download the PDB-style file with coordinates for d4edsa_.
(The format of our PDB-style files is described here.)

Timeline for d4edsa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4edsb_