Lineage for d3ugib1 (3ugi B:231-280)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2642488Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 2642489Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) (S)
  5. 2642490Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins)
    Pfam PF00130
  6. 2642513Protein automated matches [193184] (2 species)
    not a true protein
  7. 2642516Species Mouse (Mus musculus) [TaxId:10090] [193185] (7 PDB entries)
  8. 2642525Domain d3ugib1: 3ugi B:231-280 [193186]
    Other proteins in same PDB: d3ugia2, d3ugia3, d3ugib2, d3ugib3
    automated match to d1ptqa_
    complexed with 09u, po4, zn

Details for d3ugib1

PDB Entry: 3ugi (more details), 1.36 Å

PDB Description: structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase c delta
PDB Compounds: (B:) protein kinase c delta type

SCOPe Domain Sequences for d3ugib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ugib1 g.49.1.1 (B:231-280) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hrfkvynymsptfcdhcgsllwglvkqglkcedcgmnvhhkcrekvanlc

SCOPe Domain Coordinates for d3ugib1:

Click to download the PDB-style file with coordinates for d3ugib1.
(The format of our PDB-style files is described here.)

Timeline for d3ugib1: