SCOPe 2.03: Domain d3ugib_: 3ugi B:

Lineage for d3ugib_ (3ugi B:)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.49.1: Cysteine-rich domain [57889] (3 families)

5. Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins)
   Pfam PF00130

6. Protein automated matches [193184] (1 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [193185] (7 PDB entries)

8. Domain d3ugib_: 3ugi B: [193186]
   automated match to d1ptqa_
   complexed with 09u, po4, zn

Details for d3ugib_

PDB Entry: 3ugi, 1.36 Å

PDB Description: structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase c delta

PDB Compounds: (B:) protein kinase c delta type

SCOPe Domain Sequences for d3ugib_:

Sequence; same for both SEQRES and ATOM records:

>d3ugib_ g.49.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gsrrasvgshrfkvynymsptfcdhcgsllwglvkqglkcedcgmnvhhkcrekvanlce
fivtd

Timeline for d3ugib_:

• d3ugib_ first appeared in SCOPe 2.02
  
• d3ugib_ appears in SCOPe 2.04
  
• d3ugib_ appears in the current release, SCOPe 2.08, called d3ugib1