Lineage for d4b6sa_ (4b6s A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1158036Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1159436Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 1159437Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
  6. 1159550Protein automated matches [190071] (4 species)
    not a true protein
  7. Species Helicobacter pylori [TaxId:85962] [193182] (1 PDB entry)
  8. 1159568Domain d4b6sa_: 4b6s A: [193183]
    automated match to d1j2ya_
    complexed with 2hn, po4

Details for d4b6sa_

PDB Entry: 4b6s (more details)

PDB Description: structure of helicobacter pylori type ii dehydroquinase inhibited by (2s)-2-perfluorobenzyl-3-dehydroquinic acid
PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d4b6sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b6sa_ c.23.13.1 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
mkilviqgpnlnmlghrdprlygmvtldqiheimqtfvkqgnldveleffqtnfegeiid
kiqesvgsdyegiiinpgafshtsiaiadaimlagkpvievhltniqareefrknsytga
acggvimgfgplgynmalmamvnilaemkafqeaqknn

SCOPe Domain Coordinates for d4b6sa_:

Click to download the PDB-style file with coordinates for d4b6sa_.
(The format of our PDB-style files is described here.)

Timeline for d4b6sa_: