SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4b6sa_ (4b6s A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2103506Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 2103507Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 protein domains)
    automatically mapped to Pfam PF01220
  6. 2103621Protein automated matches [190071] (5 species)
    not a true protein
  7. 2103652Species Helicobacter pylori [TaxId:85962] [193182] (1 PDB entry)
  8. 2103653Domain d4b6sa_: 4b6s A: [193183]
    Other proteins in same PDB: d4b6sb_, d4b6sc_
    automated match to d1j2ya_
    complexed with 2hn, po4

Details for d4b6sa_

PDB Entry: 4b6s (more details), 1.9 Å

PDB Description: Structure of Helicobacter pylori Type II Dehydroquinase inhibited by (2S)-2-Perfluorobenzyl-3-dehydroquinic acid
PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d4b6sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b6sa_ c.23.13.1 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
mkilviqgpnlnmlghrdprlygmvtldqiheimqtfvkqgnldveleffqtnfegeiid
kiqesvgsdyegiiinpgafshtsiaiadaimlagkpvievhltniqareefrknsytga
acggvimgfgplgynmalmamvnilaemkafqeaqknn

SCOPe Domain Coordinates for d4b6sa_:

Click to download the PDB-style file with coordinates for d4b6sa_.
(The format of our PDB-style files is described here.)

Timeline for d4b6sa_: