![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.7: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47212] (1 family) ![]() automatically mapped to Pfam PF08771 |
![]() | Family a.24.7.1: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47213] (2 proteins) |
![]() | Protein mTOR FKBP12–rapamycin-binding (FRB) domain [47214] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47215] (11 PDB entries) |
![]() | Domain d4drhe1: 4drh E:2025-2112 [193177] Other proteins in same PDB: d4drha_, d4drhb2, d4drhd_, d4drhe2 automated match to d1aueb_ complexed with rap, so4 |
PDB Entry: 4drh (more details), 2.3 Å
SCOPe Domain Sequences for d4drhe1:
Sequence, based on SEQRES records: (download)
>d4drhe1 a.24.7.1 (E:2025-2112) mTOR FKBP12–rapamycin-binding (FRB) domain {Human (Homo sapiens) [TaxId: 9606]} emwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrdlmeaqew crkymksgnvkdltqawdlyyhvfrris
>d4drhe1 a.24.7.1 (E:2025-2112) mTOR FKBP12–rapamycin-binding (FRB) domain {Human (Homo sapiens) [TaxId: 9606]} emwhegleeasrlyfgernvkgmfevleplhammelketsfnqaygrdlmeaqewcrkym ksgnvkdltqawdlyyhvfrris
Timeline for d4drhe1:
![]() Domains from other chains: (mouse over for more information) d4drha_, d4drhb1, d4drhb2, d4drhd_ |