Lineage for d4drhe_ (4drh E:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1083284Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1083576Superfamily a.24.7: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47212] (1 family) (S)
  5. 1083577Family a.24.7.1: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47213] (2 proteins)
  6. 1083588Protein automated matches [193175] (1 species)
    not a true protein
  7. 1083589Species Homo sapiens [TaxId:9606] [193176] (1 PDB entry)
  8. 1083590Domain d4drhe_: 4drh E: [193177]
    automated match to d1aueb_
    complexed with rap, so4

Details for d4drhe_

PDB Entry: 4drh (more details), 2.3 Å

PDB Description: Co-crystal structure of the PPIase domain of FKBP51, Rapamycin and the FRB fragment of mTOR at low pH
PDB Compounds: (E:) Serine/threonine-protein kinase mTOR

SCOPe Domain Sequences for d4drhe_:

Sequence, based on SEQRES records: (download)

>d4drhe_ a.24.7.1 (E:) automated matches {Homo sapiens [TaxId: 9606]}
mdpefmemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrdl
meaqewcrkymksgnvkdltqawdlyyhvfrris

Sequence, based on observed residues (ATOM records): (download)

>d4drhe_ a.24.7.1 (E:) automated matches {Homo sapiens [TaxId: 9606]}
mdpefmemwhegleeasrlyfgernvkgmfevleplhammelketsfnqaygrdlmeaqe
wcrkymksgnvkdltqawdlyyhvfrris

SCOPe Domain Coordinates for d4drhe_:

Click to download the PDB-style file with coordinates for d4drhe_.
(The format of our PDB-style files is described here.)

Timeline for d4drhe_: