SCOPe 2.02: Domain d4drhe_: 4drh E:

Lineage for d4drhe_ (4drh E:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.7: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47212] (1 family)

5. Family a.24.7.1: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47213] (2 proteins)

6. Protein automated matches [193175] (1 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [193176] (1 PDB entry)

8. Domain d4drhe_: 4drh E: [193177]
   automated match to d1aueb_
   complexed with rap, so4

Details for d4drhe_

PDB Entry: 4drh, 2.3 Å

PDB Description: Co-crystal structure of the PPIase domain of FKBP51, Rapamycin and the FRB fragment of mTOR at low pH

PDB Compounds: (E:) Serine/threonine-protein kinase mTOR

SCOPe Domain Sequences for d4drhe_:

Sequence, based on SEQRES records:

>d4drhe_ a.24.7.1 (E:) automated matches {Homo sapiens [TaxId: 9606]}
mdpefmemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrdl
meaqewcrkymksgnvkdltqawdlyyhvfrris

Sequence, based on observed residues (ATOM records):

>d4drhe_ a.24.7.1 (E:) automated matches {Homo sapiens [TaxId: 9606]}
mdpefmemwhegleeasrlyfgernvkgmfevleplhammelketsfnqaygrdlmeaqe
wcrkymksgnvkdltqawdlyyhvfrris

Timeline for d4drhe_:

• d4drhe_ is new in SCOPe 2.02-stable
  
• d4drhe_ appears in SCOPe 2.03
  
• d4drhe_ appears in the current release, SCOPe 2.08, called d4drhe1