Lineage for d4eaxa_ (4eax A:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1461751Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 1461752Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 1461909Family g.17.1.3: Neurotrophin [57520] (5 proteins)
    automatically mapped to Pfam PF00243
  6. 1461944Protein automated matches [190424] (4 species)
    not a true protein
  7. 1461954Species Mouse (Mus musculus) [TaxId:10090] [193171] (1 PDB entry)
  8. 1461955Domain d4eaxa_: 4eax A: [193172]
    automated match to d1sgfy_
    complexed with s12

Details for d4eaxa_

PDB Entry: 4eax (more details), 2.3 Å

PDB Description: Mouse NGF in complex with Lyso-PS
PDB Compounds: (A:) Beta-nerve growth factor

SCOPe Domain Sequences for d4eaxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eaxa_ g.17.1.3 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcrasnpvesgcr
gidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrkat

SCOPe Domain Coordinates for d4eaxa_:

Click to download the PDB-style file with coordinates for d4eaxa_.
(The format of our PDB-style files is described here.)

Timeline for d4eaxa_: