| Class g: Small proteins [56992] (90 folds) |
| Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) ![]() |
| Family g.17.1.3: Neurotrophin [57520] (5 proteins) automatically mapped to Pfam PF00243 |
| Protein automated matches [190424] (4 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [193171] (1 PDB entry) |
| Domain d4eaxa_: 4eax A: [193172] automated match to d1sgfy_ complexed with s12 |
PDB Entry: 4eax (more details), 2.3 Å
SCOPe Domain Sequences for d4eaxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eaxa_ g.17.1.3 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcrasnpvesgcr
gidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrkat
Timeline for d4eaxa_: