| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
| Protein Glutaredoxin-like NRDH-redoxin [64052] (3 species) |
| Species Corynebacterium glutamicum [TaxId:1718] [193169] (1 PDB entry) |
| Domain d4fiwa_: 4fiw A: [193170] automated match to d1r7ha_ complexed with gol, so4 |
PDB Entry: 4fiw (more details), 1.5 Å
SCOPe Domain Sequences for d4fiwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fiwa_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium glutamicum [TaxId: 1718]}
aitvytkpacvqcnatkkaldragleydlvdisldeeareyvlalgylqapvvvadgshw
sgfrperiremataaa
Timeline for d4fiwa_: