Lineage for d4fiwa_ (4fiw A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876156Protein Glutaredoxin-like NRDH-redoxin [64052] (3 species)
  7. 2876160Species Corynebacterium glutamicum [TaxId:1718] [193169] (1 PDB entry)
  8. 2876161Domain d4fiwa_: 4fiw A: [193170]
    automated match to d1r7ha_
    complexed with gol, so4

Details for d4fiwa_

PDB Entry: 4fiw (more details), 1.5 Å

PDB Description: X-ray crystal structure of Corynebacterium glutamicum Nrdh-redoxin at 1.5A
PDB Compounds: (A:) Putative glutaredoxin NrdH

SCOPe Domain Sequences for d4fiwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fiwa_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium glutamicum [TaxId: 1718]}
aitvytkpacvqcnatkkaldragleydlvdisldeeareyvlalgylqapvvvadgshw
sgfrperiremataaa

SCOPe Domain Coordinates for d4fiwa_:

Click to download the PDB-style file with coordinates for d4fiwa_.
(The format of our PDB-style files is described here.)

Timeline for d4fiwa_: