![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.22: SPRY domain [141154] (6 proteins) Pfam PF00622 |
![]() | Protein automated matches [190921] (2 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188414] (3 PDB entries) |
![]() | Domain d3zo0b1: 3zo0 B:9-186 [193163] Other proteins in same PDB: d3zo0a1, d3zo0a2, d3zo0b2 automated match to d2volb_ complexed with fuc, man |
PDB Entry: 3zo0 (more details), 1.99 Å
SCOPe Domain Sequences for d3zo0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zo0b1 b.29.1.22 (B:9-186) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vhitldrntanswliiskdrrqvrmgdthqnvsdnkerfsnypmvlgaqrfssgkmywev dvtqkeawdlgvcrdsvqrkgqfslspengfwtiwlwqksyeagtspqttlhiqvppcqi gifvdyeagvvsfynitdhgsliytfsecvfagplrpffnvgfnysggnaaplklcpl
Timeline for d3zo0b1: