Lineage for d3zo0b1 (3zo0 B:9-186)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780523Family b.29.1.22: SPRY domain [141154] (6 proteins)
    Pfam PF00622
  6. 2780548Protein automated matches [190921] (2 species)
    not a true protein
  7. 2780551Species Mouse (Mus musculus) [TaxId:10090] [188414] (3 PDB entries)
  8. 2780555Domain d3zo0b1: 3zo0 B:9-186 [193163]
    Other proteins in same PDB: d3zo0a1, d3zo0a2, d3zo0b2
    automated match to d2volb_
    complexed with fuc, man

Details for d3zo0b1

PDB Entry: 3zo0 (more details), 1.99 Å

PDB Description: mouse igg2a in complex with mouse trim21 pryspry
PDB Compounds: (B:) e3 ubiquitin-protein ligase trim21

SCOPe Domain Sequences for d3zo0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zo0b1 b.29.1.22 (B:9-186) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vhitldrntanswliiskdrrqvrmgdthqnvsdnkerfsnypmvlgaqrfssgkmywev
dvtqkeawdlgvcrdsvqrkgqfslspengfwtiwlwqksyeagtspqttlhiqvppcqi
gifvdyeagvvsfynitdhgsliytfsecvfagplrpffnvgfnysggnaaplklcpl

SCOPe Domain Coordinates for d3zo0b1:

Click to download the PDB-style file with coordinates for d3zo0b1.
(The format of our PDB-style files is described here.)

Timeline for d3zo0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3zo0b2