Lineage for d3zlqa_ (3zlq A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1130027Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1130028Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1131756Family b.50.1.0: automated matches [191552] (1 protein)
    not a true family
  6. 1131757Protein automated matches [190954] (7 species)
    not a true protein
  7. 1131778Species Homo sapiens [TaxId:9606] [193159] (6 PDB entries)
  8. 1131788Domain d3zlqa_: 3zlq A: [193161]
    automated match to d2b8la_
    complexed with 6t9

Details for d3zlqa_

PDB Entry: 3zlq (more details), 2.1 Å

PDB Description: bace2 xaperone complex
PDB Compounds: (A:) Beta-secretase 2

SCOPe Domain Sequences for d3zlqa_:

Sequence, based on SEQRES records: (download)

>d3zlqa_ b.50.1.0 (A:) automated matches {Homo sapiens [TaxId: 9606]}
lamvdnlqgdsgrgyylemligtppqklqilvdtgssnfavagtphsyidtyfdtersst
yrskgfdvtvkytqgswtgfvgedlvtipkgfntsflvniatifesenfflpgikwngil
glayatlakpsssletffdslvtqanipnvfsmqmcgaglpvagsgtnggslvlggieps
lykgdiwytpikeewyyqieilkleiggqslnldcreynadkaivdsgttllrlpqkvfd
avveavaraslipafsdgfwtgsqlacwtnsetpwsyfpkisiylrdenssrsfritilp
qlyiqpmmgaglnyecyrfgispstnalvigatvmegfyvifdraqkrvgfaaspcaeia
gaavseisgpfstedvasncvp

Sequence, based on observed residues (ATOM records): (download)

>d3zlqa_ b.50.1.0 (A:) automated matches {Homo sapiens [TaxId: 9606]}
lamvdnlqgdsgrgyylemligtppqklqilvdtgssnfavagtphsyidtyfdtersst
yrskgfdvtvkytqgswtgfvgedlvtipkgfntsflvniatifesenfflpgikwngil
glayatlakpsssletffdslvtqanipnvfsmqmcgagggslvlggiepslykgdiwyt
pikeewyyqieilkleiggqslnldcreynadkaivdsgttllrlpqkvfdavveavara
sdgfwtgsqlacwtnsetpwsyfpkisiylrdenssrsfritilpqlyiqpmmgaglnye
cyrfgispstnalvigatvmegfyvifdraqkrvgfaaspcaeiagaavseisgpfsted
vasncvp

SCOPe Domain Coordinates for d3zlqa_:

Click to download the PDB-style file with coordinates for d3zlqa_.
(The format of our PDB-style files is described here.)

Timeline for d3zlqa_: